Source code for edelweissmeshfree.particlemanagers.oldkdbinorganizedparticlemanager

# -*- coding: utf-8 -*-
#  ---------------------------------------------------------------------
#
#  _____    _      _              _
# | ____|__| | ___| |_      _____(_)___ ___
# |  _| / _` |/ _ \ \ \ /\ / / _ \ / __/ __|
# | |__| (_| |  __/ |\ V  V /  __/ \__ \__ \
# |_____\__,_|\___|_| \_/\_/_\___|_|___/___/
# |  \/  | ___  ___| |__  / _|_ __ ___  ___
# | |\/| |/ _ \/ __| '_ \| |_| '__/ _ \/ _ \
# | |  | |  __/\__ \ | | |  _| | |  __/  __/
# |_|  |_|\___||___/_| |_|_| |_|  \___|\___|
#
#
#  Unit of Strength of Materials and Structural Analysis
#  University of Innsbruck,
#
#  Research Group for Computational Mechanics of Materials
#  Institute of Structural Engineering, BOKU University, Vienna
#
#  2023 - today
#
#  Matthias Neuner |  matthias.neuner@boku.ac.at
#  Thomas Mader    |  thomas.mader@bokut.ac.at
#
#  This file is part of EdelweissMeshfree.
#
#  This library is free software; you can redistribute it and/or
#  modify it under the terms of the GNU Lesser General Public
#  License as published by the Free Software Foundation; either
#  version 2.1 of the License, or (at your option) any later version.
#
#  The full text of the license can be found in the file LICENSE.md at
#  the top level directory of EdelweissMeshfree.
#  ---------------------------------------------------------------------


import numpy as np
from edelweissfe.journal.journal import Journal

from edelweissmeshfree.meshfree.particlekerneldomain import ParticleKernelDomain
from edelweissmeshfree.particlemanagers.base.baseparticlemanager import (
    BaseParticleManager,
)


[docs] class _KDBinOrganizer: """A class to manage the kernel functions in cartesian bins in multiple dimension for fast access. We store the bounding box of each kerne lfunction (support) in the respective (partially-)covereing bins. This way, we can quickly find for given coordinates (of particles) the shape function candidates of which the support might cover the coordinates. Parameters ---------- kernelFunctions The list of shape functions. dimension The dimension of the problem. """ def __init__(self, kernelFunctions, dimension, randomlyShiftPartliceShapeFunctions: bool | float = False): self._dimension = dimension self._kernelFunctions = kernelFunctions # we make the bin size the average of the bounding box of the shape functions # boundingBoxes = np.array([sf.getBoundingBox() for sf in kernelFunctions]) boundingBoxes = [sf.getBoundingBox() for sf in kernelFunctions] boundingBoxesMins = np.array([bb[0] for bb in boundingBoxes]) boundingBoxesMaxs = np.array([bb[1] for bb in boundingBoxes]) self._binSize = np.mean(boundingBoxesMaxs - boundingBoxesMins, axis=0) / 2 self._boundingBoxMin = np.min(boundingBoxesMins, axis=0) - 1e-12 self._boundingBoxMax = np.max(boundingBoxesMaxs, axis=0) + 1e-12 self._nBins = np.ceil((self._boundingBoxMax - self._boundingBoxMin) / self._binSize).astype(int) self._thebins = np.frompyfunc(list, 0, 1)(np.empty(self._nBins, dtype=object)) # print(self._thebins.shape) # for every shape function, we need to get the bin indices for the min. and max. bounding box: for i, kf in enumerate(kernelFunctions): minIndices = self._getBinIndices(boundingBoxes[i][0]) maxIndices = self._getBinIndices(boundingBoxes[i][1]) # now we need to loop over all bins in the bounding box of the shape function and add the shape function to the bin # 3d case: if self._dimension == 3: for i in range(minIndices[0], maxIndices[0] + 1): for j in range(minIndices[1], maxIndices[1] + 1): for k in range(minIndices[2], maxIndices[2] + 1): self._thebins[i, j, k].append(kf) # 2d case: elif self._dimension == 2: for i in range(minIndices[0], maxIndices[0] + 1): for j in range(minIndices[1], maxIndices[1] + 1): self._thebins[i, j].append(kf) # 1d case: elif self._dimension == 1: for i in range(minIndices[0], maxIndices[0] + 1): self._thebins[i].append else: raise ValueError("Dimension not supported")
[docs] def _getBinIndices(self, coordinate: np.ndarray) -> list: """Get the cartesian bin indices for a given coordinate. Parameters ---------- coordinate The coordinate for which the indices should be computed. Returns ------- list The list of indices. """ return [int((coordinate[i] - self._boundingBoxMin[i]) / self._binSize[i]) for i in range(self._dimension)]
[docs] def getKernelFunctionCandidates(self, coordinate: np.ndarray) -> list: """Get the shape function candidates for a given coordinate. Candidates are shape functions that might cover the given coordinate. It is guaranteed that all candidates are returned, but not that all returned shape functions might cover the coordinate, since this is only a fast pre-selection based on the bounding box of the shape functions. Parameters ---------- coordinate The coordinate for which the shape function candidates should be determined. Returns ------- list The list of shape function candidates. """ indices = self._getBinIndices(coordinate) thebin = self._thebins[tuple(indices)] return thebin
def __str__(self): return f"KDBin with {len(self._kernelFunctions)} shape functions in {self._nBins} bins of size {self._binSize} in a bounding box from {self._boundingBoxMin} to {self._boundingBoxMax}."
[docs] class KDBinOrganizedParticleManager(BaseParticleManager): """A k-dimensional bin organized manager for particles and meshfree shape functions for locating points in supports. Parameters ---------- meshfreeKernelFunctions The list of shape functions. particles The list of particles. dimension The dimension of the problem. journal The journal for logging messages. bondParticlesToKernelFunctions Whether to bond the particles to the kernel functions (one particle per kernel function). If True, the kernel functions are moved to the particle center coordinates at each update. randomlyShiftPartliceShapeFunctions Whether to randomly shift the shape functions a bit to avoid alignment artifacts. If a float value is given, this value is used as the maximum shift factor in each direction, which is scaled with the approximate particle size: randdisp = (np.random.rand(self._dimension) - 0.5) * np.sqrt(particle.getVolumeUndeformed()) * randomlyShiftPartliceShapeFunctions * particleSize """ def __init__( self, particleKernelDomain: ParticleKernelDomain, dimension: int, journal: Journal, bondParticlesToKernelFunctions: bool = False, randomlyShiftPartliceShapeFunctions: bool | float = False, ): self._meshfreeKernelFunctions = particleKernelDomain.meshfreeKernelFunctions self._particles = particleKernelDomain.particles self._dimension = dimension self._bondParticlesToKernelFunctions = bondParticlesToKernelFunctions self._journal = journal if not isinstance(randomlyShiftPartliceShapeFunctions, (bool, float)): raise ValueError("randomlyShiftPartliceShapeFunctions must be a boolean or a float.") self._randomlyShiftPartliceShapeFunctions = randomlyShiftPartliceShapeFunctions if self._bondParticlesToKernelFunctions: if len(self._particles) != len(self._meshfreeKernelFunctions): raise ValueError("The number of particles and kernel functions must be equal.") for particle, kernelFunction in zip(self._particles, self._meshfreeKernelFunctions): particleCoordinates = particle.getCenterCoordinates() kernelFunction.moveTo(particleCoordinates) self.signalizeKernelFunctionUpdate()
[docs] def signalizeKernelFunctionUpdate( self, ): self._theBins = _KDBinOrganizer(self._meshfreeKernelFunctions, self._dimension)
[docs] def updateConnectivity( self, ): hasChanged = False if self._bondParticlesToKernelFunctions: self._journal.message( f"Updating kernel function positions for the bonding definition with {len(self._particles)} particles.", "ParticleManager", ) for particle, kernelFunction in zip(self._particles, self._meshfreeKernelFunctions): particleCoordinates = particle.getCenterCoordinates() if self._randomlyShiftPartliceShapeFunctions: if isinstance(self._randomlyShiftPartliceShapeFunctions, float): particleVol = particle.getVolumeUndeformed() # particleSize = np.pow(particleVol, 1.0 / self._dimension) particleSize = particleVol ** (1.0 / self._dimension) randdisp = ( (np.random.rand(self._dimension) - 0.5) * np.sqrt(particle.getVolumeUndeformed()) * self._randomlyShiftPartliceShapeFunctions * particleSize ) particleCoordinates += randdisp kernelFunction.moveTo(particleCoordinates) self.signalizeKernelFunctionUpdate() for p in self._particles: evaluationCoordinates = p.getEvaluationCoordinates() # rough search based on the bounding box of the kernel functions kernelFunctionCandidates = { candidate for vertex in evaluationCoordinates for candidate in self._theBins.getKernelFunctionCandidates(vertex) } # fine search based on the actual support of the kernel functions kernelFunctions = { sf for coordinate in evaluationCoordinates for sf in kernelFunctionCandidates if sf.isCoordinateInCurrentSupport(coordinate) } # we need to sort the kernel functions using their node number to ensure that the order is always the same kernelFunctions = list(sorted(kernelFunctions, key=lambda x: x.node.label)) if hasChanged or kernelFunctions != p.kernelFunctions: hasChanged = True p.assignKernelFunctions(kernelFunctions) return hasChanged
def getCoveredDomain( self, ): return self._theBins._boundingBoxMin, self._theBins._boundingBoxMax def __str__(self): return f"KDBinOrganizedParticleManager with {len(self._particles)} particles and {len(self._meshfreeKernelFunctions)} shape functions in {self._dimension} dimensions. Covered domain: {self.getCoveredDomain()}."
[docs] def visualize(self): """For 2D only: Visualize the number of kernel functions in the bins.""" if self._dimension != 2: raise ValueError("Visualization only supported for 2D.") import matplotlib.pyplot as plt nBins = self._theBins._nBins nKernelFunctions = np.zeros(nBins) for i in range(nBins[0]): for j in range(nBins[1]): nKernelFunctions[i, j] = len(self._theBins._thebins[i, j]) plt.figure() plt.imshow( nKernelFunctions.T, ) plt.title("Number of kernel functions in the bins of the KDBinOrganizer") nBins = self._theBins._nBins # plot the lines: for i in range(nBins[0] + 1): plt.plot([i - 0.5, i - 0.5], [0 - 0.5, nBins[1] - 0.5], "k") for j in range(nBins[1] + 1): plt.plot([0 - 0.5, nBins[0] - 0.5], [j - 0.5, j - 0.5], "k") plt.colorbar() plt.show()